Anti-SIX6

Catalog Number: ATA-HPA001403
Article Name: Anti-SIX6
Biozol Catalog Number: ATA-HPA001403
Supplier Catalog Number: HPA001403
Alternative Catalog Number: ATA-HPA001403-100,ATA-HPA001403-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: OPTX2, Six9
SIX homeobox 6
Anti-SIX6
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 4990
UniProt: O95475
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRNLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGSGRALRAEGDGTPEVLGVATSPAASLSSKAATSAISITSSDSECDI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SIX6
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm.
Immunohistochemical staining of human pituitary gland shows moderate nuclear positivity in anterior cells.
Western blot analysis in human eye tissue.
Western blot analysis in control (vector only transfected HEK293T lysate) and SIX6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416023).
HPA001403-100ul
HPA001403-100ul
HPA001403-100ul