Anti-FADD
Catalog Number:
ATA-HPA001464
- Images (7)
| Article Name: | Anti-FADD |
| Biozol Catalog Number: | ATA-HPA001464 |
| Supplier Catalog Number: | HPA001464 |
| Alternative Catalog Number: | ATA-HPA001464-100,ATA-HPA001464-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GIG3, MORT1 |
| Fas (TNFRSF6)-associated via death domain |
| Anti-FADD |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 8772 |
| UniProt: | Q13158 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FADD |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & the Golgi apparatus. |
|
|
Immunohistochemical staining of human gallbladder shows cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell lines A-431 and HeLa using Anti-FADD antibody. Corresponding FADD RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1. |
|
|
Western blot analysis in human cell line Jurkat. |
|
|
HPA001464-100ul |
|
|
HPA001464-100ul |
|
|
HPA001464-100ul |
Product Guarantee and Expert Support
