Anti-C1QC
Catalog Number:
ATA-HPA001471
- Images (7)
| Article Name: | Anti-C1QC |
| Biozol Catalog Number: | ATA-HPA001471 |
| Supplier Catalog Number: | HPA001471 |
| Alternative Catalog Number: | ATA-HPA001471-100,ATA-HPA001471-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C1QG |
| complement component 1, q subcomponent, C chain |
| Anti-C1QC |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 714 |
| UniProt: | P02747 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | C1QC |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp. |
|
|
Immunohistochemical staining of human small intestine shows strong positivity in plasma. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Immunohistochemical staining of human lymphoid tissues shows moderate cytoplasmic positivity in non-germinal center cells. |
|
|
HPA001471-100ul |
|
|
HPA001471-100ul |
|
|
HPA001471-100ul |
Product Guarantee and Expert Support
