Anti-ZNF133

Catalog Number: ATA-HPA001493
Article Name: Anti-ZNF133
Biozol Catalog Number: ATA-HPA001493
Supplier Catalog Number: HPA001493
Alternative Catalog Number: ATA-HPA001493-100,ATA-HPA001493-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: pHZ-13, pHZ-66, ZNF150
zinc finger protein 133
Anti-ZNF133
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 7692
UniProt: P52736
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SKPELITQLEQGKETWREEKKCSPATCPADPEPELYLDPFCPPGFSSQKFPMQHVLCNHPPWIFTCLCAEGNIQPGDPGPGDQEKQQQASEGRPWSDQAEGPEGEGAMPLFGRTKKRTLG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ZNF133
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry analysis in human parathyroid gland and pancreas tissues using Anti-ZNF133 antibody. Corresponding ZNF133 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human parathyroid gland shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA001493-100ul
HPA001493-100ul
HPA001493-100ul