Anti-ZNF350

Catalog Number: ATA-HPA001521
Article Name: Anti-ZNF350
Biozol Catalog Number: ATA-HPA001521
Supplier Catalog Number: HPA001521
Alternative Catalog Number: ATA-HPA001521-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ZBRK1, ZFQR
zinc finger protein 350
Anti-ZNF350
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 59348
UniProt: Q9GZX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPASQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ZNF350
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & nuclear bodies.
Immunohistochemical staining of human appendix shows strong cytoplasmic positivity in lymphoid tissue.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Lane 4: Human plasma
Lane 5: Human Liver tissue
Lane 6: Human Tonsil tissue
HPA001521-100ul
HPA001521-100ul
HPA001521-100ul