Anti-IFNGR2

Catalog Number: ATA-HPA001535
Article Name: Anti-IFNGR2
Biozol Catalog Number: ATA-HPA001535
Supplier Catalog Number: HPA001535
Alternative Catalog Number: ATA-HPA001535-100,ATA-HPA001535-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AF-1, IFNGT1
interferon gamma receptor 2 (interferon gamma transducer 1)
Anti-IFNGR2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 3460
UniProt: P38484
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNIS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IFNGR2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry analysis in human stomach and liver tissues using Anti-IFNGR2 antibody. Corresponding IFNGR2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human stomach shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA001535-100ul
HPA001535-100ul
HPA001535-100ul