Anti-CA2 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA001550
Article Name: Anti-CA2 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001550
Supplier Catalog Number: HPA001550
Alternative Catalog Number: ATA-HPA001550-100,ATA-HPA001550-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CA-II, CAII, Car2
carbonic anhydrase II
Anti-CA2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 760
UniProt: P00918
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CA2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human stomach and prostate tissues using Anti-CA2 antibody. Corresponding CA2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human stomach shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
Western blot analysis in human cell lines HEK293 and PC-3 using Anti-CA2 antibody. Corresponding CA2 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
HPA001550
HPA001550
HPA001550