Anti-SYTL4
Catalog Number:
ATA-HPA001589
- Images (8)
| Article Name: | Anti-SYTL4 |
| Biozol Catalog Number: | ATA-HPA001589 |
| Supplier Catalog Number: | HPA001589 |
| Alternative Catalog Number: | ATA-HPA001589-100,ATA-HPA001589-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SYTL4 |
| synaptotagmin-like 4 |
| Anti-SYTL4 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 94121 |
| UniProt: | Q96C24 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RLKNELLEIKRKGAKRGSQHYSDRTCARCQESLGRLSPKTNTCRGCNHLVCRDCRIQESNGTWRCKVCAKEIELKKATGDWFYDQKVNRFAYRTGSEIIRMSLRHKPAVSKRETVGQSLLHQTQMGDIWPGRKIIQERQKEPSVLFEVP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SYTL4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & microtubule organizing center. |
|
|
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1, using Anti-SYTL4 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
HPA001589-100ul |
|
|
|
|
|
|
|
|
HPA001589-100ul |
|
|
HPA001589-100ul |
Product Guarantee and Expert Support
