Anti-HNRNPA1
Catalog Number:
ATA-HPA001609
- Images (6)
| Article Name: | Anti-HNRNPA1 |
| Biozol Catalog Number: | ATA-HPA001609 |
| Supplier Catalog Number: | HPA001609 |
| Alternative Catalog Number: | ATA-HPA001609-100,ATA-HPA001609-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | hnRNP-A1, hnRNPA1, HNRPA1 |
| heterogeneous nuclear ribonucleoprotein A1 |
| Anti-HNRNPA1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3178 |
| UniProt: | P09651 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ETTDESLRSHFERWGMLTDCAVMRDPNTKRSRGFGFVTYATVEEVDAATNARPHKVDGKVVEPRRTVSREDYQRSGAHLTVKKIFVGGIKENTEKHQLRDYFEQHGKMEVIEIMTEAVARKGALPL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HNRNPA1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human fallopian tube shows strong nuclear positivity. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA001609-100ul |
|
|
|
|
|
HPA001609-100ul |
|
|
HPA001609-100ul |
Product Guarantee and Expert Support
