Anti-SLC9A3R2
Catalog Number:
ATA-HPA001672
- Images (6)
| Article Name: | Anti-SLC9A3R2 |
| Biozol Catalog Number: | ATA-HPA001672 |
| Supplier Catalog Number: | HPA001672 |
| Alternative Catalog Number: | ATA-HPA001672-100,ATA-HPA001672-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | E3KARP, NHERF-2, SIP-1, TKA-1 |
| solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2 |
| Anti-SLC9A3R2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9351 |
| UniProt: | Q15599 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC9A3R2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human spleen and tonsil tissues using Anti-SLC9A3R2 antibody. Corresponding SLC9A3R2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human spleen shows high expression. |
|
|
Immunohistochemical staining of human tonsil shows low expression as expected. |
|
|
HPA001672-100ul |
|
|
HPA001672-100ul |
|
|
HPA001672-100ul |
Product Guarantee and Expert Support
