Anti-GOLIM4
Catalog Number:
ATA-HPA001677
- Images (11)
| Article Name: | Anti-GOLIM4 |
| Biozol Catalog Number: | ATA-HPA001677 |
| Supplier Catalog Number: | HPA001677 |
| Alternative Catalog Number: | ATA-HPA001677-100,ATA-HPA001677-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GIMPC, GOLPH4, GPP130, P138 |
| golgi integral membrane protein 4 |
| Anti-GOLIM4 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 27333 |
| UniProt: | O00461 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAED |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GOLIM4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus. |
|
|
Immunohistochemistry analysis in human small intestine and skin tissues using Anti-GOLIM4 antibody. Corresponding GOLIM4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, liver, skin and small intestine using Anti-GOLIM4 antibody HPA001677 (A) shows similar protein distribution across tissues to independent antibody HPA002315 (B). |
|
|
Immunohistochemical staining of human small intestine shows high expression. |
|
|
Immunohistochemical staining of human skin shows low expression as expected. |
|
|
Immunohistochemical staining of human liver using Anti-GOLIM4 antibody HPA001677. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-GOLIM4 antibody HPA001677. |
|
|
HPA001677-100ul |
|
|
|
|
|
HPA001677-100ul |
|
|
HPA001677-100ul |
Product Guarantee and Expert Support
