Anti-F13A1

Catalog Number: ATA-HPA001804
Article Name: Anti-F13A1
Biozol Catalog Number: ATA-HPA001804
Supplier Catalog Number: HPA001804
Alternative Catalog Number: ATA-HPA001804-100,ATA-HPA001804-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: F13A
coagulation factor XIII, A1 polypeptide
Anti-F13A1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 2162
UniProt: P00488
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: F13A1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-F13A1 antibody. Corresponding F13A1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA001804-100ul
HPA001804-100ul
HPA001804-100ul