Anti-APOBEC3G Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA001812
Article Name: Anti-APOBEC3G Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001812
Supplier Catalog Number: HPA001812
Alternative Catalog Number: ATA-HPA001812-100,ATA-HPA001812-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bK150C2.7, CEM15, dJ494G10.1, FLJ12740, MDS019
apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
Anti-APOBEC3G
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 60489
UniProt: Q9HC16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: APOBEC3G
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human lymph node and pancreas tissues using HPA001812 antibody. Corresponding APOBEC3G RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells.
Immunohistochemical staining of human spleen shows moderate to strong cytoplasmic positivity in cells in red pulp.
Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in lymphoid cells.
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemical staining of human pancreas shows no positivity as expected.
HPA001812
HPA001812
HPA001812