Anti-CREM

Catalog Number: ATA-HPA001818
Article Name: Anti-CREM
Biozol Catalog Number: ATA-HPA001818
Supplier Catalog Number: HPA001818
Alternative Catalog Number: ATA-HPA001818-100,ATA-HPA001818-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ChIP, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: hCREM-2
cAMP responsive element modulator
Anti-CREM
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 1390
UniProt: Q03060
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CREM
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and cerebral cortex tissues using Anti-CREM antibody. Corresponding CREM RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Western blot analysis in human cell lines PC-3 and Caco-2 using Anti-CREM antibody. Corresponding CREM RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
HPA001818-100ul
HPA001818-100ul
HPA001818-100ul