Anti-EGFL6
Catalog Number:
ATA-HPA001838
- Images (6)
| Article Name: | Anti-EGFL6 |
| Biozol Catalog Number: | ATA-HPA001838 |
| Supplier Catalog Number: | HPA001838 |
| Alternative Catalog Number: | ATA-HPA001838-100,ATA-HPA001838-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MAEG |
| EGF-like-domain, multiple 6 |
| Anti-EGFL6 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 25975 |
| UniProt: | Q8IUX8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | CSFNHGICDWKQDREDDFDWNPADRDNAIGFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRVFVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLLVSGLCPD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | EGFL6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human placenta and liver tissues using Anti-EGFL6 antibody. Corresponding EGFL6 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA001838-100ul |
|
|
HPA001838-100ul |
|
|
HPA001838-100ul |
Product Guarantee and Expert Support
