Anti-CLOCK

Catalog Number: ATA-HPA001867
Article Name: Anti-CLOCK
Biozol Catalog Number: ATA-HPA001867
Supplier Catalog Number: HPA001867
Alternative Catalog Number: ATA-HPA001867-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bHLHe8, KAT13D, KIAA0334
clock circadian regulator
Anti-CLOCK
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 9575
UniProt: O15516
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CLOCK
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
HPA001867-100ul
HPA001867-100ul
HPA001867-100ul