Anti-UPF3B

Catalog Number: ATA-HPA001882
Article Name: Anti-UPF3B
Biozol Catalog Number: ATA-HPA001882
Supplier Catalog Number: HPA001882
Alternative Catalog Number: ATA-HPA001882-100,ATA-HPA001882-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HUPF3B, MRX62, RENT3B, UPF3X
UPF3 regulator of nonsense transcripts homolog B (yeast)
Anti-UPF3B
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 65109
UniProt: Q9BZI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEALSKVVIRRLPPTLTKEQLQEHLQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYVFLDNKGQEYPAIVE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: UPF3B
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic and decidual cells.
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA001882-100ul
HPA001882-100ul
HPA001882-100ul