Anti-LAMB2

Catalog Number: ATA-HPA001895
Article Name: Anti-LAMB2
Biozol Catalog Number: ATA-HPA001895
Supplier Catalog Number: HPA001895
Alternative Catalog Number: ATA-HPA001895-100,ATA-HPA001895-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: LAMS
laminin, beta 2 (laminin S)
Anti-LAMB2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 3913
UniProt: P55268
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LAMB2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human heart muscle shows weak to moderate membranous positivity in cardiomyocytes.
Immunohistochemical staining of human kidney shows weak to moderate membranous positivity in cells in glomeruli.
Immunohistochemical staining of human cerebral cortex shows moderate membranous positivity in endothelial cells.
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human cell line A-431
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HPA001895-100ul
HPA001895-100ul
HPA001895-100ul