Anti-SOX6 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA001923
Article Name: Anti-SOX6 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001923
Supplier Catalog Number: HPA001923
Alternative Catalog Number: ATA-HPA001923-100,ATA-HPA001923-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SOX6
SRY (sex determining region Y)-box 6
Anti-SOX6
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 55553
UniProt: P35712
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TYKPGDNYPVQFIPSTMAAAAASGLSPLQLQQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEAAAQPLNLSSRPKTAEPVKSPTS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SOX6
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemical staining of human small intestine shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human glioma shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts, as well as weak positivity in Leydig cells.
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.
HPA001923
HPA001923
HPA001923