Anti-PPFIBP1
Catalog Number:
ATA-HPA001924
- Images (7)
| Article Name: | Anti-PPFIBP1 |
| Biozol Catalog Number: | ATA-HPA001924 |
| Supplier Catalog Number: | HPA001924 |
| Alternative Catalog Number: | ATA-HPA001924-100,ATA-HPA001924-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | hSGT2, hSgt2p, L2, SGT2 |
| PTPRF interacting protein, binding protein 1 (liprin beta 1) |
| Anti-PPFIBP1 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 8496 |
| UniProt: | Q86W92 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DAQGFSDLEKSPSPTPVMGSPSCDPFNTSVPEEFHTTILQVSIPSLLPATVSMETSEKSKLTPKPETSFEENDGNIILGATVDTQLCDKLLTSSLQKSSSLGNLKKETSDGEKETIQKTSEDRA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PPFIBP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells and adnexal cells. |
|
|
Western blot analysis in human cell lines Caco-2 and HEK293 using Anti-PPFIBP1 antibody. Corresponding PPFIBP1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1. |
|
|
Western blot analysis in human cell line U-87 MG. |
|
|
HPA001924-100ul |
|
|
HPA001924-100ul |
|
|
HPA001924-100ul |
Product Guarantee and Expert Support
