Anti-CD36

Catalog Number: ATA-HPA002018
Article Name: Anti-CD36
Biozol Catalog Number: ATA-HPA002018
Supplier Catalog Number: HPA002018
Alternative Catalog Number: ATA-HPA002018-100,ATA-HPA002018-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FAT, GP3B, GP4, GPIV, SCARB3
CD36 molecule (thrombospondin receptor)
Anti-CD36
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 948
UniProt: P16671
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLREL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CD36
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line HEL shows localization to the Golgi apparatus.
Immunohistochemistry analysis in human placenta and cerebral cortex tissues using Anti-CD36 antibody. Corresponding CD36 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
HPA002018-100ul
HPA002018-100ul
HPA002018-100ul