Anti-ALDH1A1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA002123
Article Name: Anti-ALDH1A1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA002123
Supplier Catalog Number: HPA002123
Alternative Catalog Number: ATA-HPA002123-100,ATA-HPA002123-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ALDH1, PUMB1, RALDH1
aldehyde dehydrogenase 1 family, member A1
Anti-ALDH1A1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 216
UniProt: P00352
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ALDH1A1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A549 shows localization to cytosol.
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Western blot analysis in human cell lines A-549 and A-431 using Anti-ALDH1A1 antibody. Corresponding ALDH1A1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western blot analysis in human cell line HepG2.
HPA002123
HPA002123
HPA002123