Anti-CD14 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA002127
Article Name: Anti-CD14 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA002127
Supplier Catalog Number: HPA002127
Alternative Catalog Number: ATA-HPA002127-100,ATA-HPA002127-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Pan-Cancer
CD14 molecule
Anti-CD14
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 929
UniProt: P08571
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CD14
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human lymph node and pancreas tissues using HPA002127 antibody. Corresponding CD14 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver, lymph node, pancreas and rectum using Anti-CD14 antibody HPA002127 (A) shows similar protein distribution across tissues to independent antibody HPA001887 (B).
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemical staining of human lymph node shows moderate to strong membranous positivity in lymphoid cells.
Immunohistochemical staining of human rectum shows moderate to strong cytoplasmic positivity in lymphoid cells.
Immunohistochemical staining of human liver shows moderate to strong membranous positivity in hepatic sinusoid cells.
Western blot analysis using Anti-CD14 antibody HPA002127 (A) shows similar pattern to independent antibody HPA001887 (B).
HPA002127
HPA002127
HPA002127