Anti-MGAM
Catalog Number:
ATA-HPA002270
- Images (6)
| Article Name: | Anti-MGAM |
| Biozol Catalog Number: | ATA-HPA002270 |
| Supplier Catalog Number: | HPA002270 |
| Alternative Catalog Number: | ATA-HPA002270-100,ATA-HPA002270-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MGA |
| maltase-glucoamylase (alpha-glucosidase) |
| Anti-MGAM |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 8972 |
| UniProt: | O43451 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWSIKIRDEEKIDCYPDENGASAENCTARGCIWEASNSSGVP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MGAM |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human duodenum and liver tissues using Anti-MGAM antibody. Corresponding MGAM RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human duodenum shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA002270-100ul |
|
|
HPA002270-100ul |
|
|
HPA002270-100ul |
Product Guarantee and Expert Support
