Anti-GOLIM4

Catalog Number: ATA-HPA002315
Article Name: Anti-GOLIM4
Biozol Catalog Number: ATA-HPA002315
Supplier Catalog Number: HPA002315
Alternative Catalog Number: ATA-HPA002315-100,ATA-HPA002315-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GIMPC, GOLPH4, GPP130, P138
golgi integral membrane protein 4
Anti-GOLIM4
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 27333
UniProt: O00461
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQEVSRNNDVWQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GOLIM4
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human small intestine and skin tissues using Anti-GOLIM4 antibody. Corresponding GOLIM4 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, liver, skin and small intestine using Anti-GOLIM4 antibody HPA002315 (A) shows similar protein distribution across tissues to independent antibody HPA001677 (B).
Immunohistochemical staining of human skin shows low expression as expected.
Immunohistochemical staining of human small intestine shows high expression.
Immunohistochemical staining of human cerebral cortex using Anti-GOLIM4 antibody HPA002315.
Immunohistochemical staining of human liver using Anti-GOLIM4 antibody HPA002315.
HPA002315-100ul
HPA002315-100ul
HPA002315-100ul