Anti-BTG2

Catalog Number: ATA-HPA002355
Article Name: Anti-BTG2
Biozol Catalog Number: ATA-HPA002355
Supplier Catalog Number: HPA002355
Alternative Catalog Number: ATA-HPA002355-100,ATA-HPA002355-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC126063, MGC126064, PC3, TIS21
BTG family, member 2
Anti-BTG2
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 7832
UniProt: P78543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: BTG2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
HPA002355-100ul
HPA002355-100ul
HPA002355-100ul