Anti-STAP2
Catalog Number:
ATA-HPA002375
- Images (7)
| Article Name: | Anti-STAP2 |
| Biozol Catalog Number: | ATA-HPA002375 |
| Supplier Catalog Number: | HPA002375 |
| Alternative Catalog Number: | ATA-HPA002375-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BKS, STAP-2 |
| signal transducing adaptor family member 2 |
| Anti-STAP2 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 55620 |
| UniProt: | Q9UGK3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | STAP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells. |
|
|
Western blot analysis in human cell lines MCF-7 and HeLa using Anti-STAP2 antibody. Corresponding STAP2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17 Lane 2: Human cell line RT-4 |
|
|
HPA002375-100ul |
|
|
|
|
|
HPA002375-100ul |
|
|
HPA002375-100ul |
Product Guarantee and Expert Support
