Anti-ANXA6

Catalog Number: ATA-HPA002462
Article Name: Anti-ANXA6
Biozol Catalog Number: ATA-HPA002462
Supplier Catalog Number: HPA002462
Alternative Catalog Number: ATA-HPA002462-100,ATA-HPA002462-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ANX6
annexin A6
Anti-ANXA6
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 309
UniProt: P08133
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLML
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ANXA6
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human appendix and pancreas tissues using Anti-ANXA6 antibody. Corresponding ANXA6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human appendix shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA002462-100ul
HPA002462-100ul
HPA002462-100ul