Anti-IRF8 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-IRF8 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA002531
• Supplier Catalog Number: HPA002531
• Alternative Catalog Number: ATA-HPA002531-100,ATA-HPA002531-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: ICSBP, ICSBP1, IRF-8

Product Description

interferon regulatory factor 8

Additional Information

Anti-IRF8

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 3394
• UniProt: Q02556
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: PDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYY
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: IRF8
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.

Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-IRF8 antibody. Corresponding IRF8 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human lymph node shows high expression.

Immunohistochemical staining of human skeletal muscle shows low expression as expected.

Western blot analysis in human cell line THP-1.

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human cell line A-431

HPA002531

HPA002531

HPA002531