Anti-TXNDC16

Catalog Number: ATA-HPA002543
Article Name: Anti-TXNDC16
Biozol Catalog Number: ATA-HPA002543
Supplier Catalog Number: HPA002543
Alternative Catalog Number: ATA-HPA002543-100,ATA-HPA002543-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1344
thioredoxin domain containing 16
Anti-TXNDC16
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 57544
UniProt: Q9P2K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PVGRGILRAYFDPLPPLPLLVLVNLHSGGQVFAFPSDQAIIEENLVLWLKKLEAGLENHITILPAQEWKPPLPAYDFLSMIDAATSQRGTRKVPKCMKETDVQENDKEQHEDKSAVRKEPIETLRIKHWN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TXNDC16
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
HPA002543-100ul
HPA002543-100ul
HPA002543-100ul