Anti-RAF1

Catalog Number: ATA-HPA002640
Article Name: Anti-RAF1
Biozol Catalog Number: ATA-HPA002640
Supplier Catalog Number: HPA002640
Alternative Catalog Number: ATA-HPA002640-100,ATA-HPA002640-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: c-Raf, CRAF, Raf-1
Raf-1 proto-oncogene, serine/threonine kinase
Anti-RAF1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 5894
UniProt: P04049
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNLSPTGWSQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RAF1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemical staining of human rectum shows moderate nuclear positivity in glandular cells.
HPA002640-100ul
HPA002640-100ul
HPA002640-100ul