Anti-RPL30

Catalog Number: ATA-HPA002651
Article Name: Anti-RPL30
Biozol Catalog Number: ATA-HPA002651
Supplier Catalog Number: HPA002651
Alternative Catalog Number: ATA-HPA002651-100,ATA-HPA002651-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: L30
ribosomal protein L30
Anti-RPL30
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 6156
UniProt: P62888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: INSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGEK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RPL30
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & endoplasmic reticulum.
Immunohistochemical staining of human cerebellum shows cytoplasmic positivity in purkinje cells and cells of molecular layer.
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA002651-100ul
HPA002651-100ul
HPA002651-100ul