Anti-CPM
Catalog Number:
ATA-HPA002657
- Images (7)
| Article Name: | Anti-CPM |
| Biozol Catalog Number: | ATA-HPA002657 |
| Supplier Catalog Number: | HPA002657 |
| Alternative Catalog Number: | ATA-HPA002657-100,ATA-HPA002657-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CPM |
| carboxypeptidase M |
| Anti-CPM |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 1368 |
| UniProt: | P14384 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHRIGIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CPM |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human endometrium shows distinct luminal membranous positivity in glandular cells. |
|
|
Western blot analysis in human cell line THP-1. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA002657-100ul |
|
|
|
|
|
HPA002657-100ul |
|
|
HPA002657-100ul |
Product Guarantee and Expert Support
