Anti-CFAP57 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA002736
Article Name: Anti-CFAP57 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA002736
Supplier Catalog Number: HPA002736
Alternative Catalog Number: ATA-HPA002736-100,ATA-HPA002736-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ32000, WDR65
cilia and flagella associated protein 57
Anti-CFAP57
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 149465
UniProt: Q96MR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PESNLVYWLWEKQKVMAIVRIDTQNNPVYQVSFSPQDNTQVCVTGNGMFKLLRFAEGTLKQTSFQRGEPQNYLAHTWVADDKIVVGTDTGKLFLFESGDQRWETSIMVKEPTNGSKSLDVIQESESLIEFPPVSSPLP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CFAP57
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-CFAP57 antibody. Corresponding CFAP57 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube, liver, lymph node and prostate using Anti-CFAP57 antibody HPA002736 (A) shows similar protein distribution across tissues to independent antibody HPA028623 (B).
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
Immunohistochemical staining of human liver using Anti-CFAP57 antibody HPA002736.
Immunohistochemical staining of human lymph node using Anti-CFAP57 antibody HPA002736.
HPA002736
HPA002736
HPA002736