Anti-DSN1
Catalog Number:
ATA-HPA002813
- Images (8)
| Article Name: | Anti-DSN1 |
| Biozol Catalog Number: | ATA-HPA002813 |
| Supplier Catalog Number: | HPA002813 |
| Alternative Catalog Number: | ATA-HPA002813-100,ATA-HPA002813-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C20orf172, dJ469A13.2, hKNL-3, KNL3, MIS13 |
| DSN1, MIS12 kinetochore complex component |
| Anti-DSN1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 79980 |
| UniProt: | Q9H410 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DSN1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and heart muscle tissues using Anti-DSN1 antibody. Corresponding DSN1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human heart muscle shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA002813-100ul |
|
|
|
|
|
HPA002813-100ul |
|
|
HPA002813-100ul |
Product Guarantee and Expert Support
