Anti-TXNL1

Catalog Number: ATA-HPA002829
Article Name: Anti-TXNL1
Biozol Catalog Number: ATA-HPA002829
Supplier Catalog Number: HPA002829
Alternative Catalog Number: ATA-HPA002829-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TRP32, Txl, TXNL
thioredoxin-like 1
Anti-TXNL1
Clonality: Polyclonal
Isotype: IgG
NCBI: 9352
UniProt: O43396
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LLLQFQSQWRRGHPAGLSVRMVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TXNL1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA002829-100ul
HPA002829-100ul
HPA002829-100ul