Anti-ABHD12B
Catalog Number:
ATA-HPA002873
- Images (6)
| Article Name: | Anti-ABHD12B |
| Biozol Catalog Number: | ATA-HPA002873 |
| Supplier Catalog Number: | HPA002873 |
| Alternative Catalog Number: | ATA-HPA002873-100,ATA-HPA002873-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BEM46L3, C14orf29 |
| abhydrolase domain containing 12B |
| Anti-ABHD12B |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 145447 |
| UniProt: | Q7Z5M8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIVFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ABHD12B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human testis shows strong nuclear positivity in cells of seminiferus ducts. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and ABHD12B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY405695). |
|
|
|
|
|
HPA002873-100ul |
|
|
HPA002873-100ul |
|
|
HPA002873-100ul |
Product Guarantee and Expert Support
