Anti-SIPA1L1
Catalog Number:
ATA-HPA002875
- Images (6)
| Article Name: | Anti-SIPA1L1 |
| Biozol Catalog Number: | ATA-HPA002875 |
| Supplier Catalog Number: | HPA002875 |
| Alternative Catalog Number: | ATA-HPA002875-100,ATA-HPA002875-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | E6TP1, KIAA0440 |
| signal-induced proliferation-associated 1 like 1 |
| Anti-SIPA1L1 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 26037 |
| UniProt: | O43166 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | IRQRSNSDITISELDVDSFDECISPTYKTGPSLHREYGSTSSIDKQGTSGESFFDLLKGYKDDKSDRGPTPTKLSDFLITGGGKGSGFSLDVIDGPISQRENLRLFKEREKPLKRRSKSETGDSSIFRKLRNAKGEELGKSSDLEDNRSE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SIPA1L1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & actin filaments. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells. |
|
|
HPA002875-100ul |
|
|
|
|
|
HPA002875-100ul |
|
|
HPA002875-100ul |
Product Guarantee and Expert Support
