Anti-STS

Catalog Number: ATA-HPA002904
Article Name: Anti-STS
Biozol Catalog Number: ATA-HPA002904
Supplier Catalog Number: HPA002904
Alternative Catalog Number: ATA-HPA002904-100,ATA-HPA002904-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ARSC, ARSC1
steroid sulfatase (microsomal), isozyme S
Anti-STS
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 412
UniProt: P08842
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIY
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: STS
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-STS antibody. Corresponding STS RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA002904-100ul
HPA002904-100ul
HPA002904-100ul