Anti-HCCS
Catalog Number:
ATA-HPA002946
- Images (7)
| Article Name: | Anti-HCCS |
| Biozol Catalog Number: | ATA-HPA002946 |
| Supplier Catalog Number: | HPA002946 |
| Alternative Catalog Number: | ATA-HPA002946-100,ATA-HPA002946-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CCHL, MLS |
| holocytochrome c synthase |
| Anti-HCCS |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3052 |
| UniProt: | P53701 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYEL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HCCS |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria. |
|
|
Immunohistochemical staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells. |
|
|
Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18 Lane 2: Human cell line RT-4 |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA002946-100ul |
|
|
HPA002946-100ul |
|
|
HPA002946-100ul |
Product Guarantee and Expert Support
