Anti-POLA1 ChIP certified

Catalog Number: ATA-HPA002947
Article Name: Anti-POLA1 ChIP certified
Biozol Catalog Number: ATA-HPA002947
Supplier Catalog Number: HPA002947
Alternative Catalog Number: ATA-HPA002947-100,ATA-HPA002947-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NSX, p180, POLA
polymerase (DNA directed), alpha 1, catalytic subunit
Anti-POLA1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 5422
UniProt: P09884
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWIESAETHVSCCVMVK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: POLA1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry analysis in human lymph node and liver tissues using Anti-POLA1 antibody. Corresponding POLA1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA002947-100ul
HPA002947-100ul
HPA002947-100ul