Anti-CASP1
Catalog Number:
ATA-HPA003056
- Images (6)
| Article Name: | Anti-CASP1 |
| Biozol Catalog Number: | ATA-HPA003056 |
| Supplier Catalog Number: | HPA003056 |
| Alternative Catalog Number: | ATA-HPA003056-100,ATA-HPA003056-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ICE, IL1BC |
| caspase 1, apoptosis-related cysteine peptidase |
| Anti-CASP1 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 834 |
| UniProt: | P29466 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CASP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human urinary bladder shows strong nuclear and cytoplasmic positivity in urothelial cells. |
|
|
Western blot analysis in human cell line U-937 MG. |
|
|
HPA003056-100ul |
|
|
|
|
|
HPA003056-100ul |
|
|
HPA003056-100ul |
Product Guarantee and Expert Support
