Anti-RAB9A

Catalog Number: ATA-HPA003094
Article Name: Anti-RAB9A
Biozol Catalog Number: ATA-HPA003094
Supplier Catalog Number: HPA003094
Alternative Catalog Number: ATA-HPA003094-100,ATA-HPA003094-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RAB9
RAB9A, member RAS oncogene family
Anti-RAB9A
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 9367
UniProt: P51151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RAB9A
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human adrenal gland and skeletal muscle tissues using Anti-RAB9A antibody. Corresponding RAB9A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human adrenal gland shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18
Lane 2: Human cell line RT-4
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla)
HPA003094-100ul
HPA003094-100ul
HPA003094-100ul