Anti-SLC6A14 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA003193
Article Name: Anti-SLC6A14 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA003193
Supplier Catalog Number: HPA003193
Alternative Catalog Number: ATA-HPA003193-100,ATA-HPA003193-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SLC6A14
solute carrier family 6 (amino acid transporter), member 14
Anti-SLC6A14
Clonality: Polyclonal
Isotype: IgG
NCBI: 11254
UniProt: Q9UN76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SLC6A14
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles.
Immunohistochemistry analysis in human lung and liver tissues using HPA003193 antibody. Corresponding SLC6A14 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human prostate shows strong membranous positivity in glandular cells.
Immunohistochemical staining of human breast shows strong membranous positivity in glandular cells.
Immunohistochemical staining of human liver shows no membranous positivity in hepatocytes as expected.
Immunohistochemical staining of human lung shows strong membranous positivity in macrophages.
HPA003193
HPA003193
HPA003193