Anti-ZNF764
Catalog Number:
ATA-HPA003203
- Images (6)
| Article Name: | Anti-ZNF764 |
| Biozol Catalog Number: | ATA-HPA003203 |
| Supplier Catalog Number: | HPA003203 |
| Alternative Catalog Number: | ATA-HPA003203-100,ATA-HPA003203-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MGC13138 |
| zinc finger protein 764 |
| Anti-ZNF764 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 92595 |
| UniProt: | Q96H86 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VYFCREEWGCLRPAQRALYRDVMRETYGHLSALGIGGNKPALISWVEEEAELWGPAAQDPEVAKCQTQTDPDSRNKKKERQREGTGALEKPDPVAAGSPGLKSPQAPSAGPPYGWEQLSKAPHRGRPSLCAHPPVPRADQRH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ZNF764 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol. |
|
|
Immunohistochemical staining of human cerebellum shows cytoplasmic positivity in purkinje cells and nuclear immunoreactivity in cells of molecular layer. |
|
|
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17 Lane 2: Human cell line RT-4 |
|
|
HPA003203-100ul |
|
|
HPA003203-100ul |
|
|
HPA003203-100ul |
Product Guarantee and Expert Support
