Anti-SAGE1

Catalog Number: ATA-HPA003208
Article Name: Anti-SAGE1
Biozol Catalog Number: ATA-HPA003208
Supplier Catalog Number: HPA003208
Alternative Catalog Number: ATA-HPA003208-100,ATA-HPA003208-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CT14, SAGE
sarcoma antigen 1
Anti-SAGE1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 55511
UniProt: Q9NXZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HSVREEKMESGKPQTDKVISNDAPQLGHMAAGGIPSMSTKDLYATVTQNVHEERMENNQPQPSYDLSTVLPGLTYLTVAGIPAMSTRDQYATVTHNVHEEKIKNGQAASDNVFSTVPPAFINMAATGVSSMSTRDQYAAVTHNIR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SAGE1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-SAGE1 antibody. Corresponding SAGE1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human endometrium shows low expression as expected.
HPA003208-100ul
HPA003208-100ul
HPA003208-100ul