Anti-CLCN5
Catalog Number:
ATA-HPA003213
- Images (6)
| Article Name: | Anti-CLCN5 |
| Biozol Catalog Number: | ATA-HPA003213 |
| Supplier Catalog Number: | HPA003213 |
| Alternative Catalog Number: | ATA-HPA003213-100,ATA-HPA003213-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ClC-5, CLC5, DENTS, hCIC-K2, hClC-K2, NPHL1, NPHL2, XLRH, XRN |
| chloride channel, voltage-sensitive 5 |
| Anti-CLCN5 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 1184 |
| UniProt: | P51795 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MAMWQGAMDNRGFQQGSFSSFQNSSSDEDLMDIPATAMDFSMRDDVPPLDREVG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CLCN5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line RH-30 shows localization to cytosol & the Golgi apparatus. |
|
|
Western blot analysis in human cell line RH-30. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue. |
|
|
HPA003213-100ul |
|
|
HPA003213-100ul |
|
|
HPA003213-100ul |
Product Guarantee and Expert Support
