Anti-TNFRSF13C
Catalog Number:
ATA-HPA003246
- Images (8)
| Article Name: | Anti-TNFRSF13C |
| Biozol Catalog Number: | ATA-HPA003246 |
| Supplier Catalog Number: | HPA003246 |
| Alternative Catalog Number: | ATA-HPA003246-100,ATA-HPA003246-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BAFFR, CD268 |
| tumor necrosis factor receptor superfamily, member 13C |
| Anti-TNFRSF13C |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 115650 |
| UniProt: | Q96RJ3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TNFRSF13C |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human tonsil and cerebral cortex tissues using Anti-TNFRSF13C antibody. Corresponding TNFRSF13C RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Immunohistochemical staining of human tonsil shows high expression. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and TNFRSF13C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409380). |
|
|
HPA003246-100ul |
|
|
|
|
|
HPA003246-100ul |
|
|
HPA003246-100ul |
Product Guarantee and Expert Support
