Anti-OLIG2

Catalog Number: ATA-HPA003254
Article Name: Anti-OLIG2
Biozol Catalog Number: ATA-HPA003254
Supplier Catalog Number: HPA003254
Alternative Catalog Number: ATA-HPA003254-100,ATA-HPA003254-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ChIP, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BHLHB1, bHLHe19, OLIGO2, PRKCBP2, RACK17
oligodendrocyte lineage transcription factor 2
Anti-OLIG2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Isotype: IgG
NCBI: 10215
UniProt: Q13516
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: OLIG2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human glioma shows moderate nuclear positivity in tumor cells.
Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA003254 antibody. Corresponding OLIG2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in oligodendrocytes.
Immunohistochemical staining of human liver shows no positivity as expected.
Western blot analysis in human cerebral cortex tissue.
HPA003254-100ul
HPA003254-100ul
HPA003254-100ul