Anti-ZNF143
Catalog Number:
ATA-HPA003263
- Images (8)
| Article Name: | Anti-ZNF143 |
| Biozol Catalog Number: | ATA-HPA003263 |
| Supplier Catalog Number: | HPA003263 |
| Alternative Catalog Number: | ATA-HPA003263-100,ATA-HPA003263-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | pHZ-1, SBF, STAF |
| zinc finger protein 143 |
| Anti-ZNF143 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 7702 |
| UniProt: | P52747 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TQSGLSQQVTLISQDGTQHVNISQADMQAIGNTITMVTQDGTPITVPAHDAVISSAGTHSVAMVTAEGTEGQQVAIVAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVATSNGTQIAVQLGEQPSLEEAIRIASRIQQGET |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ZNF143 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human testis and liver tissues using HPA003263 antibody. Corresponding ZNF143 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong nuclear positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human endometrium shows weak to moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human testis shows weak to moderate nuclear positivity in cells in seminiferous ducts. |
|
|
HPA003263-100ul |
|
|
HPA003263-100ul |
|
|
HPA003263-100ul |
Product Guarantee and Expert Support
